Anti-DBI Antibody (CAB18068)[KO Validated]

SKU:
CAB18068
€129 - €349

Description

Technical Manual

Anti-DBI Antibody [KO Validated]

Product Name:Anti-DBI Antibody [KO Validated]
Product SKU:CAB18068
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-114 of human DBI (NP_001171513.1).
Sequence:

MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI

Gene ID:1622
Swiss Prot:P07108
Synonyms:DBI; ACBD1; ACBP; CCK-RP; EP
Calculated MW:10kDa/11kDa/13kDa/14kDa/16kDa
Observed MW:10kDa
Reactivity:Human
Application:WB
Recommended Dilution:WB 1:500 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting 
Positive Samples:293T
Cellular Location:Endoplasmic reticulum, Golgi apparatus

Product Images

Anti-DBI Antibody [KO Validated] (CAB18068)

Western blot analysis of extracts from normal (control) and DBI knockout (KO) 293T cells, using DBI antibody (CAB18068) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s.

Uniprot Information

UniProt Protein Function:DBI: Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor. Belongs to the ACBP family. 6 isoforms of the human protein are produced by alternative promoter.
UniProt Protein Details:

Protein type:Lipid-binding

Chromosomal Location of Human Ortholog: 2q12-q21

Cellular Component: Golgi apparatus; mitochondrion; endoplasmic reticulum

Molecular Function:protein dimerization activity; benzodiazepine receptor binding; lipid binding

Biological Process: learning and/or memory; protein palmitoylation; triacylglycerol metabolic process; behavioral fear response; hair follicle development; transport; lateral ventricle development

UniProt Code:P07108
NCBI GenInfo Identifier:118276
NCBI Gene ID:1622
NCBI Accession:P07108.2
Molecular Weight:12kDa
NCBI Full Name:Acyl-CoA-binding protein
UniProt Protein Name:Acyl-CoA-binding protein
UniProt Synonym Protein Names:Diazepam-binding inhibitor; DBI; Endozepine; EP
Protein Family:DBIRD complex
UniProt Gene Name:DBI 
UniProt Entry Name:ACBP_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Host Species:
Rabbit
Isotype:
IgG
Research Area:
Signal Transduction
View AllClose