Recombinant Human Novel Coronavirus Spike glycoprotein(S) (E484K) (Active)

(No reviews yet) Write a Review
SKU:
PACOV0016
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 μg/ml can bind human ACE2, the EC50 is 6.597-8.187 ng/ml.
  • Activity
Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 μg/ml can bind Biotin-S Antibody, the EC50 is 21.54-26.77 ng/ml.
€4,950

Description

Recombinant Human Novel Coronavirus Spike glycoprotein(S) (E484K) (Active)

Background:

Spike glycoprotein comprises two functional subunits responsible for binding to the host cell receptor (S1 subunit) and fusion of the viral and cellular membranes (S2 subunit). For many coronavirus (CoVs), S is cleaved at the boundary between the S1 and S2 subunits, which remain non-covalently bound in the prefusion conformation. The distal S1 subunit comprises the receptor-binding domain(s) and contributes to stabilization of the prefusion state of the membrane-anchored S2 subunit that contains the fusion machinery. S is further cleaved by host proteases at the so-called S2' site located immediately upstream of the fusion peptide in all CoVs. This cleavage has been proposed to activate the protein for membrane fusion via extensive irreversible conformational changes. However, different CoVs use distinct domains within the S1 subunit to recognize a variety of attachment and entry receptors, depending on the viral species. Endemic human coronaviruses OC43 and HKU1 attach via their S domain A to 5-N-acetyl-9-O-acetyl-sialosides found on glycoproteins and glycolipids at the host cell surface to enable entry into susceptible cells. MERS-CoV S uses domain A to recognize non-acetylated sialoside attachment receptors, which likely promote subsequent binding of domain B to the entry receptor, dipeptidyl-peptidase 4. SARS-CoV and several SARS-related coronaviruses (SARSr-CoV) interact directly with angiotensin-converting enzyme 2 (ACE2) via SB to enter target cells.

Information

 
Description: Attaches the virion to the cell membrane by interacting with host receptor, initiating the infection. Binding to human ACE2 receptor and internalization of the virus into the endosomes of the host cell induces conformational changes in the Spike glycoprotein. Uses also human TMPRSS2 for priming in human lung cells which is an essential step for viral entry. Can be alternatively processed by host furin. Proteolysis by cathepsin CTSL may unmask the fusion peptide of S2 and activate membranes fusion within endosomes.
Alternative Names: S glycoprotein, Peplomer protein, Spike protein S1, Spike protein S2
Purity: Greater than 90% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
Activity: 1.) Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 µg/ml can bind human ACE2, the EC50 is 6.597-8.187 ng/ml.

2.) Measured by its binding ability in a functional ELISA. Immobilized, the EC50 is 21.54-26.77 ng/ml.
Target Names: S
Uniprot No.: P0DTC2
Species: Severe acute respiratory syndrome coronavirus 2 (2019-nCoV) (SARS-CoV-2).
Source: Mammalian cell
Subcellular Location: Virion membrane, Single-pass type I membrane protein, Host endoplasmic reticulum-Golgi intermediate compartment membrane, Single-pass type I membrane protein, Host cell membrane, Single-pass type I membrane protein.
Protein Families: Betacoronaviruses spike protein family.
Expression Region: 319-541aa(E484K)
Target Protein Sequence: RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLY
NSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIAD
YNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDIST
EIYQAGSTPCNGVKGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPA
TVCGPKKSTNLVKNKCVNF
Mol. Weight: 54.4 kDa
Protein Length: Partial
Tag Info: C-terminal mFC-tagged
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Recombinant Human Novel Coronavirus Spike glycoprotein(S) (E484K) (Active) Images

WB1 (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Activity1 Activity: Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 μg/ml can bind human ACE2, the EC50 is 6.597-8.187 ng/ml.
Activity2 Activity: Measured by its binding ability in a functional ELISA. Immobilized SARS-CoV-2-S1-RBD (E484K) at 2 μg/ml can bind Biotin-S Antibody, the EC50 is 21.54-26.77 ng/ml, bind human ACE2, the EC50 is 6.597-8.187 ng/ml.
View AllClose

0 Reviews

View AllClose