PTGS1 Rabbit Polyclonal Antibody (CAB7341)

(No reviews yet) Write a Review
SKU:
CAB7341
  • Western blot analysis of extracts of various cell lines, using PTGS1 antibody (CAB7341) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution._Lysates/proteins: 25ug per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 15s.
  • Immunohistochemistry of paraffin-embedded human liver cancer using PTGS1 antibody (CAB7341) at dilution of 1:100 (40x lens).
  • Immunofluorescence analysis of HeLa cells using PTGS1 Polyclonal Antibody (CAB7341) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
€99 - €249

Description

Technical Manual

PTGS1 Rabbit Polyclonal Antibody

Product Name:PTGS1 Rabbit Polyclonal Antibody
Product SKU:CAB7341
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This is one of two genes encoding similar enzymes that catalyze the conversion of arachinodate to prostaglandin. The encoded protein regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. Based on its ability to function as both a cyclooxygenase and as a peroxidase, the encoded protein has been identified as a moonlighting protein. The protein may promote cell proliferation during tumor progression. Alternative splicing results in multiple transcript variants.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human PTGS1 (NP_001258094.1).
Sequence:

MLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQE

Gene ID:5742
Swiss Prot:P23219
Synonyms:PTGS1; COX1; COX3; PCOX1; PES-1; PGG/HS; PGHS-1; PGHS1; PHS1; PTGHS
Calculated MW:56kDa/61kDa/64kDa/68kDa/71kDa/72kDa
Observed MW:69kDa
Reactivity:Human, Mouse, Rat
Application:WB IHC IF
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:100 - 1:200 IF 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry Immunofluorescence 
Positive Samples:HL-60, A-549, HT-29, THP-1, Mouse lung, Mouse liver, Mouse kidney, Rat brain
Cellular Location:Endoplasmic reticulum membrane, Microsome membrane, Peripheral membrane protein

Product Images

PTGS1 Rabbit Polyclonal Antibody (CAB7341)

Western blot analysis of extracts of various cell lines, using PTGS1 antibody (CAB7341) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution._Lysates/proteins: 25ug per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 15s.

PTGS1 Rabbit Polyclonal Antibody (CAB7341)

Immunohistochemistry of paraffin-embedded human liver cancer using PTGS1 antibody (CAB7341) at dilution of 1:100 (40x lens).

PTGS1 Rabbit Polyclonal Antibody (CAB7341)

Immunofluorescence analysis of HeLa cells using PTGS1 Polyclonal Antibody (CAB7341) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Uniprot Information

UniProt Protein Function:COX-1: May play an important role in regulating or promoting cell proliferation in some normal and neoplastically transformed cells. Homodimer. Belongs to the prostaglandin G/H synthase family. 2 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:EC 1.14.99.1; Lipid Metabolism - arachidonic acid; Oxidoreductase

Chromosomal Location of Human Ortholog: 9q32-q33.3

Cellular Component: endoplasmic reticulum membrane; photoreceptor outer segment; intracellular membrane-bound organelle; cytoplasm; nucleus

Molecular Function:prostaglandin-endoperoxide synthase activity; peroxidase activity; dioxygenase activity; metal ion binding; heme binding

Biological Process: regulation of blood pressure; xenobiotic metabolic process; cyclooxygenase pathway; arachidonic acid metabolic process; response to oxidative stress; lipid metabolic process; prostaglandin biosynthetic process; inflammatory response; regulation of cell proliferation

NCBI Summary:This is one of two genes encoding similar enzymes that catalyze the conversion of arachinodate to prostaglandin. The encoded protein regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. Based on its ability to function as both a cyclooxygenase and as a peroxidase, the encoded protein has been identified as a moonlighting protein. The protein may promote cell proliferation during tumor progression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
UniProt Code:P23219
NCBI GenInfo Identifier:317373262
NCBI Gene ID:5742
NCBI Accession:P23219.2
UniProt Secondary Accession:P23219,Q15122, Q3HY28, Q3HY29, Q5T7T6, Q5T7T7, Q5T7T8 A8K1V7, B4DHQ2, B4E2S5,
UniProt Related Accession:P23219
Molecular Weight:72,010 Da
NCBI Full Name:Prostaglandin G/H synthase 1
NCBI Synonym Full Names:prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase)
NCBI Official Symbol:PTGS1 
NCBI Official Synonym Symbols:COX1; COX3; PHS1; PCOX1; PES-1; PGHS1; PTGHS; PGG/HS; PGHS-1 
NCBI Protein Information:prostaglandin G/H synthase 1; PGH synthase 1; cyclooxygenase-1; prostaglandin H2 synthase 1
UniProt Protein Name:Prostaglandin G/H synthase 1
UniProt Synonym Protein Names:Cyclooxygenase-1; COX-1; Prostaglandin H2 synthase 1; PGH synthase 1; PGHS-1; PHS 1; Prostaglandin-endoperoxide synthase 1
Protein Family:Cox1 intron-like protein
UniProt Gene Name:PTGS1 
UniProt Entry Name:PGH1_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose