Description
PTGS1 Rabbit Polyclonal Antibody
Product Name: | PTGS1 Rabbit Polyclonal Antibody |
Product SKU: | CAB7341 |
Size: | 20uL, 50 uL |
Host Species: | Rabbit |
Purification Method: | Affinity purification |
Isotype: | IgG |
Background: | This is one of two genes encoding similar enzymes that catalyze the conversion of arachinodate to prostaglandin. The encoded protein regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. Based on its ability to function as both a cyclooxygenase and as a peroxidase, the encoded protein has been identified as a moonlighting protein. The protein may promote cell proliferation during tumor progression. Alternative splicing results in multiple transcript variants. |
Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 1-180 of human PTGS1 (NP_001258094.1). |
Sequence: | MLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQE |
Gene ID: | 5742 |
Swiss Prot: | P23219 |
Synonyms: | PTGS1; COX1; COX3; PCOX1; PES-1; PGG/HS; PGHS-1; PGHS1; PHS1; PTGHS |
Calculated MW: | 56kDa/61kDa/64kDa/68kDa/71kDa/72kDa |
Observed MW: | 69kDa |
Reactivity: | Human, Mouse, Rat |
Application: | WB IHC IF |
Recommended Dilution: | WB 1:500 - 1:2000 IHC 1:100 - 1:200 IF 1:50 - 1:200 |
Storage Buffer: | Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Application Key: | Western blotting Immunohistochemistry Immunofluorescence |
Positive Samples: | HL-60, A-549, HT-29, THP-1, Mouse lung, Mouse liver, Mouse kidney, Rat brain |
Cellular Location: | Endoplasmic reticulum membrane, Microsome membrane, Peripheral membrane protein |
Product Images
Western blot analysis of extracts of various cell lines, using PTGS1 antibody (CAB7341) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution._Lysates/proteins: 25ug per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 15s. | |
Immunohistochemistry of paraffin-embedded human liver cancer using PTGS1 antibody (CAB7341) at dilution of 1:100 (40x lens). | |
Immunofluorescence analysis of HeLa cells using PTGS1 Polyclonal Antibody (CAB7341) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining. |
Uniprot Information
UniProt Protein Function: | COX-1: May play an important role in regulating or promoting cell proliferation in some normal and neoplastically transformed cells. Homodimer. Belongs to the prostaglandin G/H synthase family. 2 isoforms of the human protein are produced by alternative splicing. |
UniProt Protein Details: | Protein type:EC 1.14.99.1; Lipid Metabolism - arachidonic acid; Oxidoreductase Chromosomal Location of Human Ortholog: 9q32-q33.3 Cellular Component: endoplasmic reticulum membrane; photoreceptor outer segment; intracellular membrane-bound organelle; cytoplasm; nucleus Molecular Function:prostaglandin-endoperoxide synthase activity; peroxidase activity; dioxygenase activity; metal ion binding; heme binding Biological Process: regulation of blood pressure; xenobiotic metabolic process; cyclooxygenase pathway; arachidonic acid metabolic process; response to oxidative stress; lipid metabolic process; prostaglandin biosynthetic process; inflammatory response; regulation of cell proliferation |
NCBI Summary: | This is one of two genes encoding similar enzymes that catalyze the conversion of arachinodate to prostaglandin. The encoded protein regulates angiogenesis in endothelial cells, and is inhibited by nonsteroidal anti-inflammatory drugs such as aspirin. Based on its ability to function as both a cyclooxygenase and as a peroxidase, the encoded protein has been identified as a moonlighting protein. The protein may promote cell proliferation during tumor progression. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014] |
UniProt Code: | P23219 |
NCBI GenInfo Identifier: | 317373262 |
NCBI Gene ID: | 5742 |
NCBI Accession: | P23219.2 |
UniProt Secondary Accession: | P23219,Q15122, Q3HY28, Q3HY29, Q5T7T6, Q5T7T7, Q5T7T8 A8K1V7, B4DHQ2, B4E2S5, |
UniProt Related Accession: | P23219 |
Molecular Weight: | 72,010 Da |
NCBI Full Name: | Prostaglandin G/H synthase 1 |
NCBI Synonym Full Names: | prostaglandin-endoperoxide synthase 1 (prostaglandin G/H synthase and cyclooxygenase) |
NCBI Official Symbol: | PTGS1 |
NCBI Official Synonym Symbols: | COX1; COX3; PHS1; PCOX1; PES-1; PGHS1; PTGHS; PGG/HS; PGHS-1 |
NCBI Protein Information: | prostaglandin G/H synthase 1; PGH synthase 1; cyclooxygenase-1; prostaglandin H2 synthase 1 |
UniProt Protein Name: | Prostaglandin G/H synthase 1 |
UniProt Synonym Protein Names: | Cyclooxygenase-1; COX-1; Prostaglandin H2 synthase 1; PGH synthase 1; PGHS-1; PHS 1; Prostaglandin-endoperoxide synthase 1 |
Protein Family: | Cox1 intron-like protein |
UniProt Gene Name: | PTGS1 |
UniProt Entry Name: | PGH1_HUMAN |
Additional Information
Product type: |
Antibody |
Reactivity: |
Human |
Reactivity: |
Mouse |
Reactivity: |
Rat |
Host Species: |
Rabbit |
Isotype: |
IgG |
Antibody Type: |
Polyclonal Antibody |