Anti-VDR Antibody (CAB11743)

SKU:
CAB11743
€99 - €249

Description

Technical Manual

Anti-VDR Antibody

Product Name:Anti-VDR Antibody
Product SKU:CAB11743
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes the nuclear hormone receptor for vitamin D3. This receptor also functions as a receptor for the secondary bile acid lithocholic acid. The receptor belongs to the family of trans-acting transcriptional regulatory factors and shows sequence similarity to the steroid and thyroid hormone receptors. Downstream targets of this nuclear hormone receptor are principally involved in mineral metabolism though the receptor regulates a variety of other metabolic pathways, such as those involved in the immune response and cancer. Mutations in this gene are associated with type II vitamin D-resistant rickets. A single nucleotide polymorphism in the initiation codon results in an alternate translation start site three codons downstream. Alternative splicing results in multiple transcript variants encoding different proteins.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 128-427 of human VDR (NP_000367.1).
Sequence:

QQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQKVIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDVTKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLSNTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLEVFGNEIS

Gene ID:7421
Swiss Prot:P11473
Synonyms:VDR; NR1I1; PPP1R163
Calculated MW:48kDa/53kDa
Observed MW:48KDa
Reactivity:Human
Application:WB
Recommended Dilution:WB 1:500 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting
Positive Samples:HeLa, HT-29
Cellular Location:Nucleus

Product Images

Anti-VDR Antibody (CAB11743)

Western blot analysis of extracts of various cell lines, using VDR antibody (CAB11743) at 1:500 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.

Uniprot Information

UniProt Protein Function:VDR: Nuclear hormone receptor. Transcription factor that mediates the action of vitamin D3 by controlling the expression of hormone sensitive genes. Regulates transcription of hormone sensitive genes via its association with the WINAC complex, a chromatin-remodeling complex. Recruited to promoters via its interaction with the WINAC complex subunit BAZ1B/WSTF, which mediates the interaction with acetylated histones, an essential step for VDR-promoter association. Plays a central role in calcium homeostasis. Defects in VDR are the cause of rickets vitamin D- dependent type 2A (VDDR2A). A disorder of vitamin D metabolism resulting in severe rickets, hypocalcemia and secondary hyperparathyroidism. Most patients have total alopecia in addition to rickets. Belongs to the nuclear hormone receptor family. NR1 subfamily.
UniProt Protein Details:

Protein type:DNA-binding; Transcription factor; Nuclear receptor

Chromosomal Location of Human Ortholog: 12q13.11

Cellular Component: nucleoplasm; nucleus; receptor complex

Molecular Function:retinoid X receptor binding; protein binding; DNA binding; zinc ion binding; sequence-specific DNA binding; steroid hormone receptor activity; vitamin D3 receptor activity; transcription factor activity

Biological Process: lactation; transcription initiation from RNA polymerase II promoter; positive regulation of apoptosis involved in mammary gland involution; cell morphogenesis; decidualization; negative regulation of transcription from RNA polymerase II promoter; signal transduction; intestinal absorption; cellular calcium ion homeostasis; negative regulation of cell proliferation; calcium ion transport; steroid hormone mediated signaling; positive regulation of transcription from RNA polymerase II promoter; gene expression; negative regulation of transcription, DNA-dependent; skeletal development; positive regulation of keratinocyte differentiation

Disease: Vitamin D-dependent Rickets, Type 2a; Osteoporosis

NCBI Summary:This gene encodes the nuclear hormone receptor for vitamin D3. This receptor also functions as a receptor for the secondary bile acid lithocholic acid. The receptor belongs to the family of trans-acting transcriptional regulatory factors and shows sequence similarity to the steroid and thyroid hormone receptors. Downstream targets of this nuclear hormone receptor are principally involved in mineral metabolism though the receptor regulates a variety of other metabolic pathways, such as those involved in the immune response and cancer. Mutations in this gene are associated with type II vitamin D-resistant rickets. A single nucleotide polymorphism in the initiation codon results in an alternate translation start site three codons downstream. Alternative splicing results in multiple transcript variants encoding different proteins. [provided by RefSeq, Feb 2011]
UniProt Code:P11473
NCBI GenInfo Identifier:137617
NCBI Gene ID:7421
NCBI Accession:P11473.1
UniProt Secondary Accession:P11473,Q5PSV3, B2R5Q1, G3V1V9,
UniProt Related Accession:P11473
Molecular Weight:
NCBI Full Name:Vitamin D3 receptor
NCBI Synonym Full Names:vitamin D (1,25- dihydroxyvitamin D3) receptor
NCBI Official Symbol:VDR
NCBI Official Synonym Symbols:NR1I1; PPP1R163
NCBI Protein Information:vitamin D3 receptor; 1,25-dihydroxyvitamin D3 receptor; vitamin D nuclear receptor variant 1; nuclear receptor subfamily 1 group I member 1; protein phosphatase 1, regulatory subunit 163
UniProt Protein Name:Vitamin D3 receptor
UniProt Synonym Protein Names:1,25-dihydroxyvitamin D3 receptor; Nuclear receptor subfamily 1 group I member 1
Protein Family:Vitamin D3 receptor
UniProt Gene Name:VDR
UniProt Entry Name:VDR_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Epigenetics and Nuclear Signaling
View AllClose