| Sequence: | MFHVSFRYIFGIPPLILVLLPVTSSECHIKDKEGKAYESVLMISIDELDKMTGTDSNCPNNEPNFFRKHVCDDTKEAAFLNRAARKLKQFLKMNISEEFNVHLLTVSQGTQTLVNCTSKEEKNVKEQKKNDACFLKRLLREIKTCWNKILKGSI |
| Accession: | P10168 |
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. |
| Formulation: | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. |
| Reconstitution: | Please refer to the printed manual for detailed information. |
| Background: | Mouse interleukin-7(IL-7) is the member of hemopoietin family which is important to the differentiation, proliferation, and survival of lymphocyte. Mouse IL-7 shares approximately 88% aa sequence identity with rat IL-7 and 58-60% with human, equine, bovine, ovine, porcine, feline and canine IL-7. It is widely expressed in primary and secondary lymphoid tissues cell and stromal epithelial cells of the thymus, bone marrow, and intestines. IL-7 activation of IL-7 R alpha is critical for both T cell and B cell lineage development. It is important for proliferation during certain stages of B-cell maturation. IL-7 contributes to the maintenance of all na?ve and memory T cells, mainly by promoting expression of the anti-apoptotic protein Bcl-2. It is required for optimal T cell-dendritic cell interaction. |