null

Human BCA-1 Recombinant Protein (RPPB1098)

SKU:
RPPB1098
Product type:
Recombinant Protein
Size:
20ug
Species:
Human
Target:
BCA-1
Synonyms:
C-X-C motif chemokine 13
Synonyms:
Small-inducible cytokine B13
Synonyms:
B lymphocyte chemoattractant
Synonyms:
CXC chemokine BLC
Source:
Escherichia Coli
Uniprot:
O43927
€245
Frequently bought together:

Description

Product Name:Human BCA-1 Recombinant Protein
Product Code:RPPB1098
Size:20µg
Species:Human
Target:BCA-1
Synonyms:C-X-C motif chemokine 13, Small-inducible cytokine B13, B lymphocyte chemoattractant, CXC chemokine BLC, CXCL13, BCA1, BCA-1, CXCL-13, B cell Attracting Chemokine-1, BLC, ANGIE, BLR1L, SCYB13, ANGIE2.
Source:Escherichia Coli
Physical Appearance:Sterile Filtered White lyophilized (freeze-dried) powder.
Formulation:The BCA-1 protein was lyophilized from a concentrated (0.5mg/ml) solution containing 20mM PBS & 150mM NaCl pH-7.4.
Solubility:It is recommended to reconstitute the lyophilized CXCL13 in sterile 18M?-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.
Stability:Lyophilized BCA1 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BCA1 should be stored at 4°C between 2-7 days and for future use below -18°C.For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).Please prevent freeze-thaw cycles.
Purity:Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
Amino Acid Sequence:VLEVYYTSLRCRCVQESSVFIPRRFIDRIQILPRGNG CPRKEIIVWKKNKSIVCVDPQAEWIQRMMEVLRKR SSSTLPVPVFKRKIP
Biological Activity:Determined by its ability to chemoattract human B cells using a concentration range of 1-10ng/ml corresponding to a Specific Activity of 100,000-1,000,000IU/mg.

BCA-1 is a CXC chemokine that is highly expressed in thesecondary lymphoid organs, such as follicles of the spleen, lymph nodes, and Peyer's patches. CXCL13 promotes the migration of B lymphocytes (compared to T cells and macrophages), by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR1). BCA1 therefore function in the homing of B lymphocytes to follicles. Human BCA-1 shares a 64% amino acid sequence similarity with the mouse protein and 23 - 34% amino acid sequence identity with other known CXC chemokines. Recombinant or chemically synthesized BCA1 is a potent chemoattractant for B lymphocytes but not T lymphocytes, monocytes or neutrophils. BLR1, a G protein-coupled receptor originally isolated from Burkitt’s lymphoma cells, has now been shown to be the specific receptor for BCA1. Among cells of the hematopoietic lineages, the expression of BLR-1, now designated CXCR-5, is restricted to B lymphocytes and a subpopulation of T helper memory cells.

CXCL13 Human Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 87 amino acids and having a molecular mass of 10.3 kDa. The BCA-1 is purified by proprietary chromatographic techniques.

UniProt Protein Function:CXCL13: Chemotactic for B-lymphocytes but not for T-lymphocytes, monocytes and neutrophils. Does not induce calcium release in B- lymphocytes. Binds to BLR1/CXCR5. Belongs to the intercrine alpha (chemokine CxC) family.
UniProt Protein Details:

Protein type:Secreted, signal peptide; Motility/polarity/chemotaxis; Secreted

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: extracellular space; extracellular region

Molecular Function:heparin binding; fibroblast growth factor binding; CXCR3 chemokine receptor binding; chemokine activity; protein heterodimerization activity; CCR10 chemokine receptor binding; CXCR5 chemokine receptor binding; receptor agonist activity

Biological Process: chronic inflammatory response; lymphocyte chemotaxis across high endothelial venule; response to lipopolysaccharide; regulation of angiogenesis; positive regulation of cell-cell adhesion mediated by integrin; positive regulation of integrin activation; lymph node development; regulation of cell proliferation; G-protein coupled receptor protein signaling pathway; elevation of cytosolic calcium ion concentration; cell surface receptor linked signal transduction; cell-cell signaling; regulation of humoral immune response; defense response to bacterium; germinal center formation; immune response; inflammatory response

NCBI Summary:B lymphocyte chemoattractant, independently cloned and named Angie, is an antimicrobial peptide and CXC chemokine strongly expressed in the follicles of the spleen, lymph nodes, and Peyer's patches. It preferentially promotes the migration of B lymphocytes (compared to T cells and macrophages), apparently by stimulating calcium influx into, and chemotaxis of, cells expressing Burkitt's lymphoma receptor 1 (BLR-1). It may therefore function in the homing of B lymphocytes to follicles. [provided by RefSeq, Oct 2014]
UniProt Code:O43927
NCBI GenInfo Identifier:7673945
NCBI Gene ID:10563
NCBI Accession:O43927.1
UniProt Related Accession:O43927
Molecular Weight:12,664 Da
NCBI Full Name:C-X-C motif chemokine 13
NCBI Synonym Full Names:chemokine (C-X-C motif) ligand 13
NCBI Official Symbol:CXCL13  
NCBI Official Synonym Symbols:BLC; BCA1; ANGIE; BCA-1; BLR1L; ANGIE2; SCYB13  
NCBI Protein Information:C-X-C motif chemokine 13; CXC chemokine BLC; B-cell chemoattractant; B-lymphocyte chemoattractant; b lymphocyte chemoattractant; small-inducible cytokine B13; B-cell-attracting chemokine 1; b cell-attracting chemokine 1; chemokine (C-X-C motif) ligand 13 (B-cell chemoattractant); B-cell-homing chemokine (ligand for Burkitt's lymphoma receptor-1); small inducible cytokine B subfamily (Cys-X-Cys motif), member 13 (B-cell chemoattractant)
UniProt Protein Name:C-X-C motif chemokine 13
UniProt Synonym Protein Names:Angie; B cell-attracting chemokine 1; BCA-1; B lymphocyte chemoattractant; CXC chemokine BLC; Small-inducible cytokine B13
Protein Family:Beta carbonic anhydrase
UniProt Gene Name:CXCL13  
UniProt Entry Name:CXL13_HUMAN

Related Products