| Sequence: | MNKEKELRAASPSLRHVQDLSSRVWILQNNILTAVPRKEQTVPVTITLLPCQYLDTLETNRGDPTYMGVQRPMSCLFCTKDGEQPVLQLGEGNIMEMYNKKEPVKASLFYHKKSGTTSTFESAAFPGWFIAVCSKGSCPLILTQELGEIFITDFEMIVVH | 
| Accession: | Q9JLA2 | 
| Storage: | Generally, lyophilized proteins are stable for up to 12 months when stored at -20 to -80°C. Reconstituted protein solution can be stored at 4-8°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. | 
| Shipping: | This product is provided as lyophilized powder which is shipped with ice packs. | 
| Formulation: | Lyophilized from sterile PBS, pH 7.4 Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization. Please refer to the specific buffer information in the printed manual. | 
| Reconstitution: | Please refer to the printed manual for detailed information. | 
| Background: | Human Interleukin-36α (IL-36α) is a secreted cytokine that belongs to the Interleukin 1 cytokine family. IL-36α is expressed in the immune system and the fetal brain, but not in other tissues or multiple hematopoietic cell lines. IL-36α is the only IL-1 family member found to be expressed on T-cells. IL-36α and IL-1F8 are involved in the regulation of adipose tissue gene expression. Importantly, IL-36α inhibits PPARγ expression, which may lead to a reduction in adipocyte differentiation suggesting metabolic effects of this cytokine. IL-36α, along with IL-1F8 and IL-1F9, has been shown to act as an agonist by activating the pathway involving NFκB and MAPK in an IL-1Rrp2 dependent manner. This suggest that IL-36α may signal in a similar fashion to IL-1 and IL-18 in having a binding receptor which upon ligation, recruits a second receptor as a signaling component, forming an active heterodimeric receptor complex. |