Apolipoprotein A-IV Polyclonal Antibody (CAB9792)
- SKU:
- CAB9792
Description
APOA4 Rabbit Polyclonal Antibody
| Product Name: | APOA4 Rabbit Polyclonal Antibody |
| Product SKU: | CAB9792 |
| Size: | 20uL, 50 uL |
| Host Species: | Rabbit |
| Purification Method: | Affinity purification |
| Isotype: | IgG |
| Background: | Apoliprotein (apo) A-IV gene contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'UTR of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo A-IV is a potent activator of lecithin-cholesterol acyltransferase in vitro. |
| Immunogen: | Recombinant fusion protein containing a sequence corresponding to amino acids 227-396 of human APOA4 (NP_000473.2). |
| Sequence: | AQDTQEKLNHQLEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQQQEQQQEQQQEQVQMLAPLES |
| Gene ID: | 337 |
| Swiss Prot: | P06727 |
| Synonyms: | APOA4 |
| Calculated MW: | 45kDa |
| Observed MW: | 45kDa |
| Reactivity: | Human, Mouse, Rat |
| Application: | WB |
| Recommended Dilution: | WB 1:500 - 1:2000 |
| Storage Buffer: | Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Application Key: | Western blotting |
| Positive Samples: | Raji, Rat testis |
| Cellular Location: | Secreted |
Product Images
| Western blot analysis of extracts of various cell lines, using APOA4 antibody (CAB9792) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Uniprot Information
| UniProt Protein Function: | APOA4: May have a role in chylomicrons and VLDL secretion and catabolism. Required for efficient activation of lipoprotein lipase by ApoC-II; potent activator of LCAT. Apoa-IV is a major component of HDL and chylomicrons. Synthesized primarily in the intestine and secreted in plasma. Belongs to the apolipoprotein A1/A4/E family. |
| UniProt Protein Details: | Protein type:Cell adhesion; Endoplasmic reticulum; Lipid-binding; Secreted; Secreted, signal peptide Chromosomal Location of Human Ortholog: 11q23.3 Cellular Component: cell surface; chylomicron; cytosol; early endosome; endoplasmic reticulum lumen; extracellular matrix; extracellular region; extracellular space Molecular Function:antioxidant activity; cholesterol binding; cholesterol transporter activity; copper ion binding; lipid binding; lipid transporter activity; phosphatidylcholine binding; protein binding; protein homodimerization activity Biological Process: cellular protein metabolic process; cholesterol biosynthetic process; cholesterol efflux; cholesterol homeostasis; cholesterol metabolic process; hydrogen peroxide catabolic process; innate immune response in mucosa; leukocyte adhesion; lipid homeostasis; lipid transport; lipoprotein metabolic process; multicellular organismal lipid catabolic process; neuron projection regeneration; phosphatidylcholine metabolic process; phospholipid efflux; positive regulation of fatty acid biosynthetic process; positive regulation of lipoprotein lipase activity; protein-lipid complex assembly; regulation of cholesterol transport; regulation of intestinal cholesterol absorption; removal of superoxide radicals; response to lipid hydroperoxide; retinoid metabolic process; reverse cholesterol transport |
| NCBI Summary: | Apoliprotein (apo) A-IV gene contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'UTR of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo A-IV is a potent activator of lecithin-cholesterol acyltransferase in vitro. [provided by RefSeq, Jul 2008] |
| UniProt Code: | P06727 |
| NCBI GenInfo Identifier: | 93163358 |
| NCBI Gene ID: | 337 |
| NCBI Accession: | P06727.3 |
| UniProt Secondary Accession: | P06727,Q14CW8, Q6Q787, A8MSL6, |
| UniProt Related Accession: | P06727 |
| Molecular Weight: | |
| NCBI Full Name: | Apolipoprotein A-IV |
| NCBI Synonym Full Names: | apolipoprotein A4 |
| NCBI Official Symbol: | APOA4 |
| NCBI Protein Information: | apolipoprotein A-IV |
| UniProt Protein Name: | Apolipoprotein A-IV |
| UniProt Synonym Protein Names: | Apolipoprotein A4 |
| Protein Family: | Apolipoprotein |
| UniProt Gene Name: | APOA4 |
Additional Information
Product type: |
Antibody |
Application: |
WB |
Reactivity: |
Human |
Reactivity: |
Mouse |
Reactivity: |
Rat |
Host Species: |
Rabbit |
Isotype: |
IgG |
Related Products
COX IV Rabbit Polyclonal Antibody (CAB1263)
COX IV Rabbit Polyclonal Antibody (CAB6564)
Rat Apolipoprotein C-IV (Apoc4) ELISA Kit
Bovine Apolipoprotein C-IV (APOC4) ELISA Kit
