Apolipoprotein A-IV Polyclonal Antibody (CAB9792)

(No reviews yet) Write a Review
SKU:
CAB9792
€99 - €249

Description

Technical Manual

APOA4 Rabbit Polyclonal Antibody

Product Name:APOA4 Rabbit Polyclonal Antibody
Product SKU:CAB9792
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

Apoliprotein (apo) A-IV gene contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'UTR of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo A-IV is a potent activator of lecithin-cholesterol acyltransferase in vitro.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 227-396 of human APOA4 (NP_000473.2).
Sequence:

AQDTQEKLNHQLEGLTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQVEEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQQQEQQQEQQQEQVQMLAPLES

Gene ID:337
Swiss Prot:P06727
Synonyms:APOA4
Calculated MW:45kDa
Observed MW:45kDa
Reactivity:Human, Mouse, Rat
Application:WB
Recommended Dilution:WB 1:500 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting 
Positive Samples:Raji, Rat testis
Cellular Location:Secreted

Product Images

Apolipoprotein A-IV Polyclonal Antibody (CAB9792)

Western blot analysis of extracts of various cell lines, using APOA4 antibody (CAB9792) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.

Uniprot Information

UniProt Protein Function:APOA4: May have a role in chylomicrons and VLDL secretion and catabolism. Required for efficient activation of lipoprotein lipase by ApoC-II; potent activator of LCAT. Apoa-IV is a major component of HDL and chylomicrons. Synthesized primarily in the intestine and secreted in plasma. Belongs to the apolipoprotein A1/A4/E family.
UniProt Protein Details:

Protein type:Cell adhesion; Endoplasmic reticulum; Lipid-binding; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 11q23.3

Cellular Component: cell surface; chylomicron; cytosol; early endosome; endoplasmic reticulum lumen; extracellular matrix; extracellular region; extracellular space

Molecular Function:antioxidant activity; cholesterol binding; cholesterol transporter activity; copper ion binding; lipid binding; lipid transporter activity; phosphatidylcholine binding; protein binding; protein homodimerization activity

Biological Process: cellular protein metabolic process; cholesterol biosynthetic process; cholesterol efflux; cholesterol homeostasis; cholesterol metabolic process; hydrogen peroxide catabolic process; innate immune response in mucosa; leukocyte adhesion; lipid homeostasis; lipid transport; lipoprotein metabolic process; multicellular organismal lipid catabolic process; neuron projection regeneration; phosphatidylcholine metabolic process; phospholipid efflux; positive regulation of fatty acid biosynthetic process; positive regulation of lipoprotein lipase activity; protein-lipid complex assembly; regulation of cholesterol transport; regulation of intestinal cholesterol absorption; removal of superoxide radicals; response to lipid hydroperoxide; retinoid metabolic process; reverse cholesterol transport

NCBI Summary:Apoliprotein (apo) A-IV gene contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'UTR of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo A-IV is a potent activator of lecithin-cholesterol acyltransferase in vitro. [provided by RefSeq, Jul 2008]
UniProt Code:P06727
NCBI GenInfo Identifier:93163358
NCBI Gene ID:337
NCBI Accession:P06727.3
UniProt Secondary Accession:P06727,Q14CW8, Q6Q787, A8MSL6,
UniProt Related Accession:P06727
Molecular Weight:
NCBI Full Name:Apolipoprotein A-IV
NCBI Synonym Full Names:apolipoprotein A4
NCBI Official Symbol:APOA4 
NCBI Protein Information:apolipoprotein A-IV
UniProt Protein Name:Apolipoprotein A-IV
UniProt Synonym Protein Names:Apolipoprotein A4
Protein Family:Apolipoprotein
UniProt Gene Name:APOA4 
View AllClose

Additional Information

Product type:
Antibody
Application:
WB
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
View AllClose

0 Reviews

View AllClose