Histone H2A.1 Rabbit Polyclonal Antibody (CAB9895)

(No reviews yet) Write a Review
SKU:
CAB9895
€99 - €249

Description

Technical Manual

Histone H2A.1 Rabbit Polyclonal Antibody

Product Name:Histone H2A.1 Rabbit Polyclonal Antibody
Product SKU:CAB9895
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the small histone gene cluster on chromosome 6p22-p21.3.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-129 of human Histone H2A.1 (NP_064707.1).
Sequence:

MDLHLFDYSEPGNFSDISWPCNSSDCIVVDTVMCPNMPNKSVLLYTLSFIYIFIFVIGMIANSVVVWVNIQAKTTGYDTHCYILNLAIADLWVVLTIPVWVVSLVQHNQWPMGELTCKVTHLIFSINLF

Gene ID:8329
Swiss Prot:P0C0S8
Synonyms:HIST1H2AI; H2A/c; H2AFC
Calculated MW:14kDa
Observed MW:14kDa
Reactivity:Human, Mouse, Rat, Other (Wide Range)
Application:WB IHC
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry 
Positive Samples:MCF7, SW480, A-549, HeLa, K-562, Mouse heart, Mouse intestine
Cellular Location:Chromosome, Nucleus

Product Images

Histone H2A.1 Rabbit Polyclonal Antibody (CAB9895)

Western blot - Histone H2A.1 Rabbit pAb (CAB9895)

Uniprot Information

UniProt Protein Function:H2A.1: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA. Belongs to the histone H2A family.
UniProt Protein Details:

Protein type:DNA-binding

Chromosomal Location of Human Ortholog: 6p22.1

Cellular Component: nuclear chromatin; nucleus

Molecular Function:DNA binding; enzyme binding; protein binding

Biological Process: chromatin silencing

NCBI Summary:Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H2A family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. This gene is found in the histone microcluster on chromosome 6p21.33. [provided by RefSeq, Aug 2015]
UniProt Code:P0C0S8
NCBI GenInfo Identifier:83288406
NCBI Gene ID:8969
NCBI Accession:P0C0S8.2
UniProt Secondary Accession:P0C0S8,P02261, Q2M1R2, Q76PA6,
UniProt Related Accession:P0C0S8
Molecular Weight:14kDa
NCBI Full Name:Histone H2A type 1
NCBI Synonym Full Names:histone cluster 1 H2A family member g
NCBI Official Symbol:HIST1H2AG 
NCBI Official Synonym Symbols:H2AG; H2A/p; H2AFP; H2A.1b; pH2A/f 
NCBI Protein Information:histone H2A type 1
UniProt Protein Name:Histone H2A type 1
UniProt Synonym Protein Names:Histone H2A/p
UniProt Gene Name:HIST1H2AG 
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Reactivity:
Other (Wide Range)
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose