[KO Validated] CAT Rabbit Polyclonal Antibody (CAB18018)

(No reviews yet) Write a Review
SKU:
CAB18018
€129 - €349

Description

Technical Manual

[KO Validated] CAT Rabbit Polyclonal Antibody

Product Name:[KO Validated] CAT Rabbit Polyclonal Antibody
Product SKU:CAB18018
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells. Catalase converts the reactive oxygen species hydrogen peroxide to water and oxygen and thereby mitigates the toxic effects of hydrogen peroxide. Oxidative stress is hypothesized to play a role in the development of many chronic or late-onset diseases such as diabetes, asthma, Alzheimer's disease, systemic lupus erythematosus, rheumatoid arthritis, and cancers. Polymorphisms in this gene have been associated with decreases in catalase activity but, to date, acatalasemia is the only disease known to be caused by this gene.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-225 of human CAT (NP_001743.1).
Sequence:

MADSRDPASDQMQHWKEQRAAQKADVLTTGAGNPVGDKLNVITVGPRGPLLVQDVVFTDEMAHFDRERIPERVVHAKGAGAFGYFEVTHDITKYSKAKVFEHIGKKTPIAVRFSTVAGESGSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDPILFPSFIHSQKRNPQTHLKDPDMVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNA

Gene ID:847
Swiss Prot:P04040
Synonyms:CAT; catalase; MGC138422; MGC138424
Calculated MW:59kDa
Observed MW:60kDa
Reactivity:Human, Mouse, Rat
Application:WB IP
Recommended Dilution:WB 1:1000 - 1:3000 IP 1:20 - 1:50
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunoprecipitation 
Positive Samples:HeLa
Cellular Location:Peroxisome

Product Images

[KO Validated] CAT Rabbit Polyclonal Antibody (CAB18018)

Western blot analysis of extracts from normal (control) and CAT knockout (KO) HeLa cells, using CAT antibody (CAB18018) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.

Uniprot Information

UniProt Protein Function:Catalase: Occurs in almost all aerobically respiring organisms and serves to protect cells from the toxic effects of hydrogen peroxide. Promotes growth of cells including T-cells, B-cells, myeloid leukemia cells, melanoma cells, mastocytoma cells and normal and transformed fibroblast cells. Homotetramer. Belongs to the catalase family.
UniProt Protein Details:

Protein type:Amino Acid Metabolism - tryptophan; Endoplasmic reticulum; EC 1.11.1.6; Apoptosis; Energy Metabolism - methane; Mitochondrial; Hydrolase; Oxidoreductase

Chromosomal Location of Human Ortholog: 11p13

Cellular Component: peroxisomal membrane; Golgi apparatus; peroxisomal matrix; focal adhesion; intracellular membrane-bound organelle; membrane; endoplasmic reticulum; lysosome; plasma membrane; mitochondrial intermembrane space; peroxisome; cytosol

Molecular Function:antioxidant activity; oxidoreductase activity, acting on peroxide as acceptor; enzyme binding; protein homodimerization activity; catalase activity; metal ion binding; heme binding; NADP binding; aminoacylase activity; receptor binding

Biological Process: cholesterol metabolic process; hemoglobin metabolic process; nucleobase, nucleoside and nucleotide metabolic process; purine base metabolic process; activation of NF-kappaB transcription factor; protein homotetramerization; osteoblast differentiation; positive regulation of phosphoinositide 3-kinase cascade; response to vitamin E; response to reactive oxygen species; triacylglycerol metabolic process; response to hyperoxia; UV protection; hydrogen peroxide catabolic process; inhibition of NF-kappaB transcription factor; ureteric bud development; positive regulation of cell division; response to hypoxia; aerobic respiration; purine nucleotide catabolic process; protein tetramerization; negative regulation of apoptosis; aging

Disease: Acatalasemia

NCBI Summary:This gene encodes catalase, a key antioxidant enzyme in the bodies defense against oxidative stress. Catalase is a heme enzyme that is present in the peroxisome of nearly all aerobic cells. Catalase converts the reactive oxygen species hydrogen peroxide to water and oxygen and thereby mitigates the toxic effects of hydrogen peroxide. Oxidative stress is hypothesized to play a role in the development of many chronic or late-onset diseases such as diabetes, asthma, Alzheimer's disease, systemic lupus erythematosus, rheumatoid arthritis, and cancers. Polymorphisms in this gene have been associated with decreases in catalase activity but, to date, acatalasemia is the only disease known to be caused by this gene. [provided by RefSeq, Oct 2009]
UniProt Code:P04040
NCBI GenInfo Identifier:115702
NCBI Gene ID:847
NCBI Accession:P04040.3
UniProt Related Accession:P04040
Molecular Weight:
NCBI Full Name:Catalase
NCBI Synonym Full Names:catalase
NCBI Official Symbol:CAT 
NCBI Protein Information:catalase
UniProt Protein Name:Catalase
Protein Family:Catalase
UniProt Gene Name:CAT 
UniProt Entry Name:CATA_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
View AllClose

0 Reviews

View AllClose