Anti-CYP27B1 Antibody (CAB1716)

SKU:
CAB1716
  • Cell Biology Antibodies 7 Anti-CYP27B1 Antibody CAB1716
  • Cell Biology Antibodies 7 Anti-CYP27B1 Antibody CAB1716
€99 - €249

Description

Technical Manual

Anti-CYP27B1 Antibody

Product Name:Anti-CYP27B1 Antibody
Product SKU:CAB1716
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the inner mitochondrial membrane where it hydroxylates 25-hydroxyvitamin D3 at the 1alpha position. This reaction synthesizes 1alpha, 25-dihydroxyvitamin D3, the active form of vitamin D3, which binds to the vitamin D receptor and regulates calcium metabolism. Thus this enzyme regulates the level of biologically active vitamin D and plays an important role in calcium homeostasis. Mutations in this gene can result in vitamin D-dependent rickets type I.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 25-195 of human CYP27B1 (NP_000776.1).
Sequence:

LGYREYHSARRSLADIPGPSTPSFLAELFCKGGLSRLHELQVQGAAHFGPVWLASFGTVRTVYVAAPALVEELLRQEGPRPERCSFSPWTEHRRCRQRACGLLTAEGEEWQRLRSLLAPLLLRPQAAARYAGTLNNVVCDLVRRLRRQRGRGTGPPALVRDVAGEFYKFGL

Gene ID:1594
Swiss Prot:O15528
Synonyms:CYP27B1; CP2B; CYP1; CYP1alpha; CYP27B; P450c1; PDDR; VDD1; VDDR; VDDRI; VDR
Calculated MW:56kDa
Observed MW:63kDa
Reactivity:Human, Rat
Application:WB IF
Recommended Dilution:WB 1:500 - 1:2000 IF 1:20 - 1:50
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunofluorescence
Positive Samples:Rat kidney, Rat liver
Cellular Location:Mitochondrion membrane

Product Images

Anti-CYP27B1 Antibody (CAB1716)

Western blot analysis of extracts of various cell lines, using CYP27B1 antibody (CAB1716) at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.

Anti-CYP27B1 Antibody (CAB1716)

Immunofluorescence analysis of HeLa cells using CYP27B1 antibody (CAB1716) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Uniprot Information

UniProt Protein Function:CYP27B1: Catalyzes the conversion of 25-hydroxyvitamin D3 (25(OH)D) to 1-alpha,25-dihydroxyvitamin D3 (1,25(OH)2D) plays an important role in normal bone growth, calcium metabolism, and tissue differentiation. Defects in CYP27B1 are the cause of rickets vitamin D- dependent type 1A (VDDR1A); also known as pseudovitamin D deficiency rickets (PDDR). A disorder caused by a selective deficiency of the active form of vitamin D (1,25- dihydroxyvitamin D3) and resulting in defective bone mineralization and clinical features of rickets. Belongs to the cytochrome P450 family.
UniProt Protein Details:

Protein type:Oxidoreductase; Mitochondrial; Lipid Metabolism - steroid biosynthesis; Cell cycle regulation; EC 1.14.13.13

Chromosomal Location of Human Ortholog: 12q14.1

Cellular Component: cytoplasm; mitochondrial outer membrane; mitochondrion

Molecular Function:calcidiol 1-monooxygenase activity

Biological Process: bone mineralization; calcium ion homeostasis; calcium ion transport; decidualization; negative regulation of cell growth; negative regulation of cell proliferation; positive regulation of keratinocyte differentiation; regulation of bone mineralization; response to estrogen stimulus; response to lipopolysaccharide; response to vitamin D; vitamin D metabolic process; vitamin metabolic process

Disease: Vitamin D Hydroxylation-deficient Rickets, Type 1a

NCBI Summary:This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. The protein encoded by this gene localizes to the inner mitochondrial membrane where it hydroxylates 25-hydroxyvitamin D3 at the 1alpha position. This reaction synthesizes 1alpha,25-dihydroxyvitamin D3, the active form of vitamin D3, which binds to the vitamin D receptor and regulates calcium metabolism. Thus this enzyme regulates the level of biologically active vitamin D and plays an important role in calcium homeostasis. Mutations in this gene can result in vitamin D-dependent rickets type I. [provided by RefSeq, Jul 2008]
UniProt Code:O15528
NCBI GenInfo Identifier:3182968
NCBI Gene ID:1594
NCBI Accession:O15528.1
UniProt Secondary Accession:O15528,Q548T3, B2RC61,
UniProt Related Accession:O15528
Molecular Weight:56,504 Da
NCBI Full Name:25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial
NCBI Synonym Full Names:cytochrome P450 family 27 subfamily B member 1
NCBI Official Symbol:CYP27B1
NCBI Official Synonym Symbols:VDR; CP2B; CYP1; PDDR; VDD1; VDDR; VDDRI; CYP27B; P450c1; CYP1alpha
NCBI Protein Information:25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial
UniProt Protein Name:25-hydroxyvitamin D-1 alpha hydroxylase, mitochondrial
UniProt Synonym Protein Names:25-OHD-1 alpha-hydroxylase; 25-hydroxyvitamin D(3) 1-alpha-hydroxylase; VD3 1A hydroxylase; Calcidiol 1-monooxygenase; Cytochrome P450 subfamily XXVIIB polypeptide 1; Cytochrome P450C1 alpha; Cytochrome P450VD1-alpha; Cytochrome p450 27B1
Protein Family:25-hydroxyvitamin D-1 alpha hydroxylase
UniProt Gene Name:CYP27B1
UniProt Entry Name:CP27B_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose