SLC7A11 Rabbit Polyclonal Antibody (CAB15604)

(No reviews yet) Write a Review
SKU:
CAB15604
€99 - €249

Description

Technical Manual

Technical Manual

SLC7A11 Rabbit Polyclonal Antibody

Product Name: SLC7A11 Rabbit Polyclonal Antibody
Product SKU: CAB15604
Size: 20uL, 50 uL
Host Species: Rabbit
Purification Method: Affinity purification
Isotype: IgG
Background:

This gene encodes a member of a heteromeric, sodium-independent, anionic amino acid transport system that is highly specific for cysteine and glutamate. In this system, designated Xc(-), the anionic form of cysteine is transported in exchange for glutamate. This protein has been identified as the predominant mediator of Kaposi sarcoma-associated herpesvirus fusion and entry permissiveness into cells. Also, increased expression of this gene in primary gliomas (compared to normal brain tissue) was associated with increased glutamate secretion via the XCT channels, resulting in neuronal cell death.

Immunogen: A synthetic peptide corresponding to a sequence within amino acids 150-250 of human SLC7A11 (NP_055146.1).
Sequence:

ILEPFFIQCEIPELAIKLITAVGITVVMVLNSMSVSWSARIQIFLTFCKLTAILIIIVPGVMQLIKGQTQNFKDAFSGRDSSITRLPLAFYYGMYAYAGWF

Gene ID: 23657
Swiss Prot: Q9UPY5
Synonyms: SLC7A11; CCBR1; xCT
Calculated MW: 55kDa
Observed MW: 55kDa/35kDa
Reactivity: Rat
Application: WB
Recommended Dilution: WB 1:500 - 1:2000
Storage Buffer: Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key: Western blotting    
Positive Samples: Rat liver, Rat kidney
Cellular Location: Membrane, Multi-pass membrane protein

Product Images

SLC7A11 Rabbit Polyclonal Antibody (CAB15604)

Western blot analysis of extracts of various cell lines, using SLC7A11 antibody (CAB15604) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s.

Uniprot Information

UniProt Protein Function: Sodium-independent, high-affinity exchange of anionic amino acids with high specificity for anionic form of cystine and glutamate.
NCBI Summary: This gene encodes a member of a heteromeric, sodium-independent, anionic amino acid transport system that is highly specific for cysteine and glutamate. In this system, designated Xc(-), the anionic form of cysteine is transported in exchange for glutamate. This protein has been identified as the predominant mediator of Kaposi sarcoma-associated herpesvirus fusion and entry permissiveness into cells. Also, increased expression of this gene in primary gliomas (compared to normal brain tissue) was associated with increased glutamate secretion via the XCT channels, resulting in neuronal cell death. [provided by RefSeq, Sep 2011]
UniProt Code: Q9UPY5
NCBI GenInfo Identifier: 7657683
NCBI Gene ID: 23657
NCBI Accession: NP_055146.1
UniProt Secondary Accession: Q9UPY5,A8K2U4,
UniProt Related Accession: Q9UPY5
Molecular Weight: Observed: 40 kDa-45 kDaPredicted: 56 kDa
NCBI Full Name: cystine/glutamate transporter
NCBI Synonym Full Names: solute carrier family 7 member 11
NCBI Official Symbol: SLC7A11  
NCBI Official Synonym Symbols: xCT; CCBR1  
NCBI Protein Information: cystine/glutamate transporter
UniProt Protein Name: Cystine/glutamate transporter
UniProt Synonym Protein Names: Amino acid transport system xc-; Calcium channel blocker resistance protein CCBR1; Solute carrier family 7 member 11; xCT
Protein Family: Protein XAP5 CIRCADIAN TIMEKEEPER
UniProt Gene Name: SLC7A11  
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose