Anti-USP2 Antibody (CAB10399)

SKU:
CAB10399
€99 - €249

Description

Technical Manual

Anti-USP2 Antibody

Product Name:Anti-USP2 Antibody
Product SKU:CAB10399
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a member of the family of de-ubiquitinating enzymes, which belongs to the peptidase C19 superfamily. The encoded protein is a ubiquitin-specific protease which is required for TNF-alpha (tumor necrosis factor alpha) -induced NF-kB (nuclear factor kB) signaling. This protein deubiquitinates polyubiquitinated target proteins such as fatty acid synthase, murine double minute 2 (MDM2), MDM4/MDMX and cyclin D1. MDM2 and MDM4 are negative regulators of the p53 tumor suppressor and cyclin D1 is required for cell cycle G1/S transition. Multiple alternatively spliced transcript variants encoding different isoforms have been identified.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 200-430 of human USP2 (NP_004196.4).
Sequence:

ENYGRKGSASQVPSQAPPSRVPEIISPTYRPIGRYTLWETGKGQAPGPSRSSSPGRDGMNSKSAQGLAGLRNLGNTCFMNSILQCLSNTRELRDYCLQRLYMRDLHHGSNAHTALVEEFAKLIQTIWTSSPNDVVSPSEFKTQIQRYAPRFVGYNQQDAQEFLRFLLDGLHNEVNRVTLRPKSNPENLDHLPDDEKGRQMWRKYLEREDSRIGDLFVGQLKSSLTCTDCGY

Gene ID:9099
Swiss Prot:O75604
Synonyms:USP2; UBP41; USP9
Calculated MW:40kDa/41kDa/45kDa/68kDa
Observed MW:72kDa
Reactivity:Human
Application:WB
Recommended Dilution:WB 1:500 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting
Positive Samples:DU145, MCF7
Cellular Location:Cytoplasm, Nucleus, perinuclear region

Product Images

Anti-USP2 Antibody (CAB10399)

Western blot analysis of extracts of various cell lines, using USP2 antibody (CAB10399) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s.

Uniprot Information

UniProt Protein Function:USP2: Hydrolase that deubiquitinates polyubiquitinated target proteins such as MDM2, MDM4 and CCND1. Isoform 1 and isoform 4 possess both ubiquitin-specific peptidase and isopeptidase activities. Deubiquitinates MDM2 without reversing MDM2-mediated p53/TP53 ubiquitination and thus indirectly promotes p53/TP53 degradation and limits p53 activity. Has no deubiquitinase activity against p53/TP53. Prevents MDM2-mediated degradation of MDM4. Plays a role in the G1/S cell-cycle progression in normal and cancer cells. Plays a role in the regulation of myogenic differentiation of embryonic muscle cells. Homooligomer. Found in trimeric complex with MDM2 and MDM4 and UPB2. Interacts with CCND1; the interaction is direct and promotes its stabilization by antagonizing ubiquitin-dependent degradation. Interacts (via N-terminus and C- terminus) with MDM2. Interacts with MDM4. Down-regulated by cisplatin. Expressed in mesangial cells of the kidney and in different types of glomerulonephritides. Cleavage is inhibited by ubiquitin in a dosage- dependent manner. Cleavage is blocked by ubiquitin aldehyde. Belongs to the peptidase C19 family. USP2 subfamily. 4 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:Ubiquitin-specific protease; Protease; EC 3.4.19.12

Chromosomal Location of Human Ortholog: 11q23.3

Cellular Component: centrosome; perinuclear region of cytoplasm; cytoplasm; cell cortex; nucleus

Molecular Function:identical protein binding; protein binding; cyclin binding; ubiquitin protein ligase binding; metal ion binding; cysteine-type endopeptidase activity; ubiquitin-specific protease activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; negative regulation of skeletal muscle development; muscle development; protein deubiquitination; protein stabilization; positive regulation of skeletal muscle development; negative regulation of transcription from RNA polymerase II promoter; positive regulation of mitotic cell cycle; cell cycle; circadian behavior; entrainment of circadian clock by photoperiod; locomotor rhythm; circadian regulation of gene expression

NCBI Summary:This gene encodes a member of the family of de-ubiquitinating enzymes, which belongs to the peptidase C19 superfamily. The encoded protein is a ubiquitin-specific protease which is required for TNF-alpha (tumor necrosis factor alpha) -induced NF-kB (nuclear factor kB) signaling. This protein deubiquitinates polyubiquitinated target proteins such as fatty acid synthase, murine double minute 2 (MDM2), MDM4/MDMX and cyclin D1. MDM2 and MDM4 are negative regulators of the p53 tumor suppressor and cyclin D1 is required for cell cycle G1/S transition. Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]
UniProt Code:O75604
NCBI GenInfo Identifier:20141855
NCBI Gene ID:9099
NCBI Accession:O75604.2
UniProt Secondary Accession:O75604,Q8IUM2, Q8IW04, Q96MB9, Q9BQ21, B0YJB8, E9PPM2
UniProt Related Accession:O75604
Molecular Weight:605
NCBI Full Name:Ubiquitin carboxyl-terminal hydrolase 2
NCBI Synonym Full Names:ubiquitin specific peptidase 2
NCBI Official Symbol:USP2
NCBI Official Synonym Symbols:USP9; UBP41
NCBI Protein Information:ubiquitin carboxyl-terminal hydrolase 2; ubiquitin thioesterase 2; deubiquitinating enzyme 2; ubiquitin specific protease 9; ubiquitin specific protease 12; 41 kDa ubiquitin-specific protease; ubiquitin-specific-processing protease 2
UniProt Protein Name:Ubiquitin carboxyl-terminal hydrolase 2
UniProt Synonym Protein Names:41 kDa ubiquitin-specific protease; Deubiquitinating enzyme 2; Ubiquitin thioesterase 2; Ubiquitin-specific-processing protease 2
Protein Family:Protein
UniProt Gene Name:USP2
UniProt Entry Name:UBP2_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose