Anti-CTSF Antibody (CAB10469)

SKU:
CAB10469
  • Cell Biology Antibodies 1 Anti-CTSF Antibody CAB10469
  • Cell Biology Antibodies 1 Anti-CTSF Antibody CAB10469
€99 - €249

Description

Technical Manual

Anti-CTSF Antibody

Product Name:Anti-CTSF Antibody
Product SKU:CAB10469
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

Cathepsins are papain family cysteine proteinases that represent a major component of the lysosomal proteolytic system. Cathepsins generally contain a signal sequence, followed by a propeptide and then a catalytically active mature region. The very long (251 amino acid residues) proregion of the cathepsin F precursor contains a C-terminal domain similar to the pro-segment of cathepsin L-like enzymes, a 50-residue flexible linker peptide, and an N-terminal domain predicted to adopt a cystatin-like fold. The cathepsin F proregion is unique within the papain family cysteine proteases in that it contains this additional N-terminal segment predicted to share structural similarities with cysteine protease inhibitors of the cystatin superfamily. This cystatin-like domain contains some of the elements known to be important for inhibitory activity. CTSF encodes a predicted protein of 484 amino acids which contains a 19 residue signal peptide. Cathepsin F contains five potential N-glycosylation sites, and it may be targeted to the endosomal/lysosomal compartment via the mannose 6-phosphate receptor pathway. The cathepsin F gene is ubiquitously expressed, and it maps to chromosome 11q13, close to the gene encoding cathepsin W.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 270-484 of human CTSF (NP_003784.2).
Sequence:

LAPPEWDWRSKGAVTKVKDQGMCGSCWAFSVTGNVEGQWFLNQGTLLSLSEQELLDCDKMDKACMGGLPSNAYSAIKNLGGLETEDDYSYQGHMQSCNFSAEKAKVYINDSVELSQNEQKLAAWLAKRGPISVAINAFGMQFYRHGISRPLRPLCSPWLIDHAVLLVGYGNRSDVPFWAIKNSWGTDWGEKGYYYLHRGSGACGVNTMASSAVVD

Gene ID:8722
Swiss Prot:Q9UBX1
Synonyms:CTSF; CATSF; CLN13
Calculated MW:53kDa
Observed MW:53kDa
Reactivity:Human, Mouse
Application:WB IHC IF
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:50 - 1:100 IF 1:50 - 1:100
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry Immunofluorescence
Positive Samples:U-251MG, SKOV3
Cellular Location:Lysosome

Product Images

Anti-CTSF Antibody (CAB10469)

Western blot analysis of extracts of various cell lines, using CTSF antibody (CAB10469) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s.

Anti-CTSF Antibody (CAB10469)

Immunohistochemistry of paraffin-embedded human breast cancer using CTSF antibody (CAB10469) at dilution of 1:100 (40x lens).

Uniprot Information

UniProt Protein Function:CTSF: Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Has also been implicated in tumor invasion and metastasis. Belongs to the peptidase C1 family.
UniProt Protein Details:

Protein type:EC 3.4.22.41; Protease

Chromosomal Location of Human Ortholog: 11q13

Cellular Component: extracellular space; lysosomal lumen; lysosome

Molecular Function:cysteine-type endopeptidase activity

Biological Process: antigen processing and presentation of exogenous peptide antigen via MHC class II; proteolysis; proteolysis involved in cellular protein catabolic process

Disease: Ceroid Lipofuscinosis, Neuronal, 13

NCBI Summary:Cathepsins are papain family cysteine proteinases that represent a major component of the lysosomal proteolytic system. Cathepsins generally contain a signal sequence, followed by a propeptide and then a catalytically active mature region. The very long (251 amino acid residues) proregion of the cathepsin F precursor contains a C-terminal domain similar to the pro-segment of cathepsin L-like enzymes, a 50-residue flexible linker peptide, and an N-terminal domain predicted to adopt a cystatin-like fold. The cathepsin F proregion is unique within the papain family cysteine proteases in that it contains this additional N-terminal segment predicted to share structural similarities with cysteine protease inhibitors of the cystatin superfamily. This cystatin-like domain contains some of the elements known to be important for inhibitory activity. CTSF encodes a predicted protein of 484 amino acids which contains a 19 residue signal peptide. Cathepsin F contains five potential N-glycosylation sites, and it may be targeted to the endosomal/lysosomal compartment via the mannose 6-phosphate receptor pathway. The cathepsin F gene is ubiquitously expressed, and it maps to chromosome 11q13, close to the gene encoding cathepsin W. [provided by RefSeq, Jul 2008]
UniProt Code:Q9UBX1
NCBI GenInfo Identifier:12643325
NCBI Gene ID:8722
NCBI Accession:Q9UBX1.1
UniProt Secondary Accession:Q9UBX1,O95240, Q9NSU4, Q9UKQ5, B2R964,
UniProt Related Accession:Q9UBX1
Molecular Weight:53,366 Da
NCBI Full Name:Cathepsin F
NCBI Synonym Full Names:cathepsin F
NCBI Official Symbol:CTSF
NCBI Official Synonym Symbols:CATSF; CLN13
NCBI Protein Information:cathepsin F
UniProt Protein Name:Cathepsin F
Protein Family:Cathepsin
UniProt Gene Name:CTSF
UniProt Entry Name:CATF_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose