Anti-CLEC2D Antibody (CAB10421)

SKU:
CAB10421
€99 - €249

Description

Technical Manual

Anti-CLEC2D Antibody

Product Name:Anti-CLEC2D Antibody
Product SKU:CAB10421
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 60-154 of human CLEC2D (NP_037401.1).
Sequence:

RANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQ

Gene ID:29121
Swiss Prot:Q9UHP7
Synonyms:CLEC2D; CLAX; LLT1; OCIL
Calculated MW:10kDa/14kDa/17kDa/21kDa/22kDa
Observed MW:38kDa
Reactivity:Human, Mouse
Application:WB
Recommended Dilution:WB 1:500 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting
Positive Samples:Raji, HL-60, LO2, U-87MG, Mouse heart
Cellular Location:Cell membrane, Cell surface, Endoplasmic reticulum, Single-pass type II membrane protein

Product Images

Anti-CLEC2D Antibody (CAB10421)

Western blot analysis of extracts of various cell lines, using CLEC2D antibody (CAB10421) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s.

Uniprot Information

UniProt Protein Function:CLEC2D: Receptor for KLRB1 that protects target cells against natural killer cell-mediated lysis. Inhibits osteoclast formation. Inhibits bone resorption. Modulates the release of interferon- gamma. Binds high molecular weight sulfated glycosaminoglycans. 6 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: cell surface; membrane; endoplasmic reticulum; integral to plasma membrane

Molecular Function:transmembrane receptor activity; carbohydrate binding

Biological Process: cell surface receptor linked signal transduction

NCBI Summary:This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene. [provided by RefSeq, Oct 2010]
UniProt Code:Q9UHP7
NCBI GenInfo Identifier:74753331
NCBI Gene ID:29121
NCBI Accession:Q9UHP7.1
UniProt Secondary Accession:Q9UHP7,Q6YID5, Q8WUP7, Q9HD37, Q9HD38, D6CI39, D6CI40 D6CI41,
UniProt Related Accession:Q9UHP7
Molecular Weight:10,823 Da
NCBI Full Name:C-type lectin domain family 2 member D
NCBI Synonym Full Names:C-type lectin domain family 2, member D
NCBI Official Symbol:CLEC2D
NCBI Official Synonym Symbols:CLAX; LLT1; OCIL
NCBI Protein Information:C-type lectin domain family 2 member D; LLT-1; C-type lectin related f; lectin-like transcript 1; lectin-like NK cell receptor; osteoclast inhibitory lectin; C-type lectin superfamily 2, member D
UniProt Protein Name:C-type lectin domain family 2 member D
UniProt Synonym Protein Names:Lectin-like NK cell receptor; Lectin-like transcript 1; LLT-1; Osteoclast inhibitory lectin
Protein Family:C-type lectin domain family
UniProt Gene Name:CLEC2D
UniProt Entry Name:CLC2D_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose