PPAT Rabbit Polyclonal Antibody (CAB6698)

(No reviews yet) Write a Review
SKU:
CAB6698
  • Western blot analysis of extracts of various cell lines, using PPAT antibody (CAB6698) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.
  • Immunofluorescence analysis of HeLa cells using PPAT Polyclonal Antibody (CAB6698) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
€99 - €249

Description

Technical Manual

PPAT Rabbit Polyclonal Antibody

Product Name:PPAT Rabbit Polyclonal Antibody
Product SKU:CAB6698
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

The protein encoded by this gene is a member of the purine/pyrimidine phosphoribosyltransferase family. It is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosythetic pathway. This gene and PAICS/AIRC gene, a bifunctional enzyme catalyzing steps six and seven of this pathway, are located in close proximity on chromosome 4, and divergently transcribed from an intergenic region.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human PPAT (NP_002694.3).
Sequence:

MELEELGIREECGVFGCIASGEWPTQLDVPHVITLGLVGLQHRGQESAGIVTSDGSSVPTFKSHKGMGLVNHVFTEDNLKKLYVSNLGIGHTRYATTGKCELENCQPFVVETLHGKIAVAHNGELVNAARLRKKLLRHGIGLSTSSDSEMITQLLAYTPPQEQDDTPDWVARIKNLMKEAPTAYSLLIMHRDVIYAVRDPYGNRPLCIGRLIPVSDINDKEKKTSETEGWVVSSESCSFLSIGARYYREVLPGEIVEISRHNVQTLDIISRSEGNPVAFC

Gene ID:5471
Swiss Prot:Q06203
Synonyms:PPAT; ATASE; GPAT; PRAT
Calculated MW:57kDa
Observed MW:55kDa
Reactivity:Human, Mouse, Rat
Application:WB IF
Recommended Dilution:WB 1:500 - 1:2000 IF 1:50 - 1:100
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunofluorescence 
Positive Samples:HepG2, COS-7
Cellular Location:

Product Images

PPAT Rabbit Polyclonal Antibody (CAB6698)

Western blot analysis of extracts of various cell lines, using PPAT antibody (CAB6698) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s.

PPAT Rabbit Polyclonal Antibody (CAB6698)

Immunofluorescence analysis of HeLa cells using PPAT Polyclonal Antibody (CAB6698) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Uniprot Information

UniProt Protein Function:ATASE: Homotetramer.
UniProt Protein Details:

Protein type:Nucleotide Metabolism - purine; Amino Acid Metabolism - alanine, aspartate and glutamate; Transferase; EC 2.4.2.14

Chromosomal Location of Human Ortholog: 4q12

Cellular Component: cytosol

Molecular Function:amidophosphoribosyltransferase activity

Biological Process: purine nucleotide biosynthetic process; purine ribonucleoside monophosphate biosynthetic process

NCBI Summary:The protein encoded by this gene is a member of the purine/pyrimidine phosphoribosyltransferase family. It is a regulatory allosteric enzyme that catalyzes the first step of de novo purine nucleotide biosythetic pathway. This gene and PAICS/AIRC gene, a bifunctional enzyme catalyzing steps six and seven of this pathway, are located in close proximity on chromosome 4, and divergently transcribed from an intergenic region. [provided by RefSeq, Mar 2011]
UniProt Code:Q06203
NCBI GenInfo Identifier:548638
NCBI Gene ID:5471
NCBI Accession:Q06203.1
UniProt Related Accession:Q06203
Molecular Weight:57,399 Da
NCBI Full Name:Amidophosphoribosyltransferase
NCBI Synonym Full Names:phosphoribosyl pyrophosphate amidotransferase
NCBI Official Symbol:PPAT 
NCBI Official Synonym Symbols:GPAT; PRAT; ATASE 
NCBI Protein Information:amidophosphoribosyltransferase
UniProt Protein Name:Amidophosphoribosyltransferase
UniProt Synonym Protein Names:Glutamine phosphoribosylpyrophosphate amidotransferase; GPAT
Protein Family:Pyridoxamine--pyruvate transaminase
UniProt Gene Name:PPAT 
UniProt Entry Name:PUR1_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose