Anti-RAB27B Antibody (CAB10389)

SKU:
CAB10389
€99 - €249

Description

Technical Manual

Anti-RAB27B Antibody

Product Name:Anti-RAB27B Antibody
Product SKU:CAB10389
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-218 of human RAB27B (NP_004154.2).
Sequence:

MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDTAGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARELADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC

Gene ID:5874
Swiss Prot:O00194
Synonyms:RAB27B; C25KG
Calculated MW:24kDa
Observed MW:25kDa
Reactivity:Human, Mouse, Rat
Application:WB
Recommended Dilution:WB 1:500 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting
Positive Samples:U-87MG, A375, Mouse lung, Mouse brain, Rat brain, Rat spleen
Cellular Location:Lipid-anchor, Membrane

Product Images

Anti-RAB27B Antibody (CAB10389)

Western blot analysis of extracts of various cell lines, using RAB27B antibody (CAB10389) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.

Uniprot Information

UniProt Protein Function:RAB27B: May be involved in targeting uroplakins to urothelial apical membranes. Belongs to the small GTPase superfamily. Rab family.
UniProt Protein Details:

Protein type:G protein, monomeric, Rab; G protein, monomeric

Chromosomal Location of Human Ortholog: 18q21.2

Cellular Component: Golgi stack; melanosome; secretory granule; trans-Golgi network transport vesicle

Molecular Function:GDP binding; GTP binding; GTPase activity; myosin V binding; protein binding; protein domain specific binding

Biological Process: melanosome transport; positive regulation of exocytosis

NCBI Summary:Members of the Rab protein family, including RAB27B, are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking (Chen et al., 1997 [PubMed 9066979]).[supplied by OMIM, Nov 2010]
UniProt Code:O00194
NCBI GenInfo Identifier:14917027
NCBI Gene ID:5874
NCBI Accession:O00194.4
UniProt Secondary Accession:O00194,Q9BZB6, B2RAB0,
UniProt Related Accession:O00194
Molecular Weight:24,608 Da
NCBI Full Name:Ras-related protein Rab-27B
NCBI Synonym Full Names:RAB27B, member RAS oncogene family
NCBI Official Symbol:RAB27B
NCBI Official Synonym Symbols:C25KG
NCBI Protein Information:ras-related protein Rab-27B
UniProt Protein Name:Ras-related protein Rab-27B
UniProt Synonym Protein Names:C25KG
Protein Family:Ras-related protein
UniProt Gene Name:RAB27B
UniProt Entry Name:RB27B_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose