RANKL Rabbit Polyclonal Antibody (CAB2550)

(No reviews yet) Write a Review
SKU:
CAB2550
  • Western blot analysis of extracts of various cell lines, using RANKL antibody (CAB2550) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.
  • Immunohistochemistry of paraffin-embedded human colon using RANKL Antibody (CAB2550) at dilution of 1:100 (40x lens).
  • Immunofluorescence analysis of Jurkat cells using RANKL antibody (CAB2550) at dilution of 1:100. Blue: DAPI for nuclear staining.
€99 - €249

Description

Technical Manual

RANKL Rabbit Polyclonal Antibody

Product Name:RANKL Rabbit Polyclonal Antibody
Product SKU:CAB2550
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 78-317 of human RANKL (NP_003692.1).
Sequence:

RISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID

Gene ID:8600
Swiss Prot:O14788
Synonyms:TNFSF11; CD254; ODF; OPGL; OPTB2; RANKL; TNLG6B; TRANCE; hRANKL2; sOdf
Calculated MW:27kDa/30kDa/35kDa
Observed MW:32kDa
Reactivity:Human, Mouse, Rat
Application:WB IHC IF
Recommended Dilution:WB 1:500 - 1:2000 IHC 1:50 - 1:200 IF 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunohistochemistry Immunofluorescence 
Positive Samples:BT-474, HepG2, Mouse spleen
Cellular Location:Cell membrane, Cytoplasm, Secreted, Single-pass type II membrane protein, Single-pass type II membrane protein

Product Images

RANKL Rabbit Polyclonal Antibody (CAB2550)

Western blot analysis of extracts of various cell lines, using RANKL antibody (CAB2550) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.

RANKL Rabbit Polyclonal Antibody (CAB2550)

Immunohistochemistry of paraffin-embedded human colon using RANKL Antibody (CAB2550) at dilution of 1:100 (40x lens).

RANKL Rabbit Polyclonal Antibody (CAB2550)

Immunofluorescence analysis of Jurkat cells using RANKL antibody (CAB2550) at dilution of 1:100. Blue: DAPI for nuclear staining.

Uniprot Information

UniProt Protein Function:TNFSF11: Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy. Homotrimer. Up-regulated by T-cell receptor stimulation. Highest in the peripheral lymph nodes, weak in spleen, peripheral blood Leukocytes, bone marrow, heart, placenta, skeletal muscle, stomach and thyroid. Belongs to the tumor necrosis factor family. 3 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:Membrane protein, integral

Chromosomal Location of Human Ortholog: 13q14

Cellular Component: extracellular space; integral to plasma membrane; cytoplasm; extracellular region

Molecular Function:cytokine activity; tumor necrosis factor receptor superfamily binding; tumor necrosis factor receptor binding

Biological Process: ossification; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of osteoclast differentiation; cytokine and chemokine mediated signaling pathway; mammary gland epithelial cell proliferation; osteoclast differentiation; activation of JNK activity; positive regulation of corticotropin-releasing hormone secretion; positive regulation of homotypic cell-cell adhesion; activation of NF-kappaB transcription factor; calcium ion homeostasis; monocyte chemotaxis; positive regulation of protein kinase B signaling cascade; positive regulation of MAP kinase activity; organ morphogenesis; tumor necrosis factor-mediated signaling pathway; positive regulation of bone resorption; immune response; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; positive regulation of T cell activation; protein homooligomerization; bone resorption

Disease: Osteopetrosis, Autosomal Recessive 2

NCBI Summary:This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found. [provided by RefSeq, Jul 2008]
UniProt Code:O14788
NCBI GenInfo Identifier:12643360
NCBI Gene ID:8600
NCBI Accession:O14788.1
UniProt Secondary Accession:O14788,O14723, Q96Q17, Q9P2Q3,
UniProt Related Accession:O14788
Molecular Weight:30,523 Da
NCBI Full Name:Tumor necrosis factor ligand superfamily member 11
NCBI Synonym Full Names:tumor necrosis factor (ligand) superfamily, member 11
NCBI Official Symbol:TNFSF11 
NCBI Official Synonym Symbols:ODF; OPGL; sOdf; CD254; OPTB2; RANKL; TRANCE; hRANKL2 
NCBI Protein Information:tumor necrosis factor ligand superfamily member 11; osteoprotegerin ligand; osteoclast differentiation factor; TNF-related activation-induced cytokine; receptor activator of nuclear factor kappa B ligand; receptor activator of nuclear factor kappa-B ligand
UniProt Protein Name:Tumor necrosis factor ligand superfamily member 11
UniProt Synonym Protein Names:Osteoclast differentiation factor; ODF; Osteoprotegerin ligand; OPGL; Receptor activator of nuclear factor kappa-B ligand; RANKL; TNF-related activation-induced cytokine; TRANCE; CD_antigen: CD254Cleaved into the following 2 chains:Tumor necrosis factor ligand superfamily member 11, membrane form; Tumor necrosis factor ligand superfamily member 11, soluble form
UniProt Gene Name:TNFSF11 
UniProt Entry Name:TNF11_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
View AllClose

0 Reviews

View AllClose