TRIM31 Rabbit Polyclonal Antibody

(No reviews yet) Write a Review
SKU:
CAB10639
€99 - €249

Description

Technical Manual

TRIM31 Rabbit Polyclonal Antibody

Product Name:TRIM31 Rabbit Polyclonal Antibody
Product SKU:CAB10639
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a protein that functions as an E3 ubiquitin-protein ligase. This gene shows altered expression in certain tumors and may be a negative regulator of cell growth. Alternative splicing results in multiple transcript variants.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 186-425 of human TRIM31 (NP_008959.3).
Sequence:

ELLHQVLEEEKNFLLSRIYWLGHEGTEAGKHYVASTEPQLNDLKKLVDSLKTKQNMPPRQLLEDIKVVLCRSEEFQFLNPTPVPLELEKKLSEAKSRHDSITGSLKKFKDQLQADRKKDENRFFKSMNKNDMKSWGLLQKNNHKMNKTSEPGSSSAGGRTTSGPPNHHSSAPSHSLFRASSAGKVTFPVCLLASYDEISGQGASSQDTKTFDVALSEELHAALSEWLTAIRAWFCEVPSS

Gene ID:11074
Swiss Prot:Q9BZY9
Synonyms:TRIM31; C6orf13; HCG1; HCGI; RNF
Calculated MW:30kDa/48kDa
Observed MW:48kDa
Reactivity:Human, Mouse
Application:WB IF
Recommended Dilution:WB 1:500 - 1:2000 IF 1:50 - 1:200
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting Immunofluorescence 
Positive Samples:HT-29, Mouse large intestine, Mouse small intestine
Cellular Location:Cytoplasm, Mitochondrion

Product Images

TRIM31 Rabbit Polyclonal Antibody

Western blot - TRIM31 Rabbit pAb (CAB10639)

Uniprot Information

UniProt Protein Function:TRIM31: Regulator of Src-induced anchorage independent cell growth. May have E3 ubiquitin-protein ligase activity. Belongs to the TRIM/RBCC family. 2 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Protein type:EC 6.3.2.-; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: cytosol

Molecular Function:protein binding

Biological Process: innate immune response; negative regulation of viral transcription; negative regulation of virion penetration into host cell; positive regulation of transcription factor activity

NCBI Summary:This gene encodes a protein that functions as an E3 ubiquitin-protein ligase. This gene shows altered expression in certain tumors and may be a negative regulator of cell growth. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
UniProt Code:Q9BZY9
NCBI GenInfo Identifier:68068082
NCBI Gene ID:11074
NCBI Accession:Q9BZY9.2
UniProt Secondary Accession:Q9BZY9,Q53H52, Q5RI37, Q5SRJ7, Q5SRJ8, Q5SS28, Q96AK4 Q96AP8, Q99579, Q9BZY8, A6NLX6, A9R9Q4,
UniProt Related Accession:Q9BZY9
Molecular Weight:30,831 Da
NCBI Full Name:E3 ubiquitin-protein ligase TRIM31
NCBI Synonym Full Names:tripartite motif containing 31
NCBI Official Symbol:TRIM31 
NCBI Official Synonym Symbols:RNF; HCG1; HCGI; C6orf13 
NCBI Protein Information:E3 ubiquitin-protein ligase TRIM31
UniProt Protein Name:E3 ubiquitin-protein ligase TRIM31
UniProt Synonym Protein Names:Tripartite motif-containing protein 31
Protein Family:E3 ubiquitin-protein ligase
UniProt Gene Name:TRIM31 
UniProt Entry Name:TRI31_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose