Anti-ENTPD3 Antibody (CAB10424)

SKU:
CAB10424
€99 - €249

Description

Technical Manual

Anti-ENTPD3 Antibody

Product Name:Anti-ENTPD3 Antibody
Product SKU:CAB10424
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a plasma membrane-bound divalent cation-dependent E-type nucleotidase. The encoded protein is involved in the regulation of extracellular levels of ATP by hydrolysis of it and other nucleotides. Multiple transcript variants have been described.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 45-366 of human ENTPD3 (NP_001278890.1).
Sequence:

IHKQEVLPPGLKYGIVLDAGSSRTTVYVYQWPAEKENNTGVVSQTFKCSVKGSGISSYGNNPQDVPRAFEECMQKVKGQVPSHLHGSTPIHLGATAGMRLLRLQNETAANEVLESIQSYFKSQPFDFRGAQIISGQEEGVYGWITANYLMGNFLEKNLWHMWVHPHGVETTGALDLGGASTQISFVAGEKMDLNTSDIMQVSLYGYVYTLYTHSFQCYGRNEAEKKFLAMLLQNSPTKNHLTNPCYPRDYSISFTMGHVFDSLCTVDQRPESYNPNDVITFEGTGDPSLCKEKVASIFDFKACHDQETCSFDGVYQPKIKGP

Gene ID:956
Swiss Prot:O75355
Synonyms:ENTPD3; CD39L3; HB6; NTPDase-3
Calculated MW:50kDa/59kDa
Observed MW:59kDa
Reactivity:Mouse
Application:WB
Recommended Dilution:WB 1:500 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting
Positive Samples:Mouse lung
Cellular Location:Membrane, Multi-pass membrane protein

Product Images

Anti-ENTPD3 Antibody (CAB10424)

Western blot analysis of extracts of mouse lung, using ENTPD3 antibody (CAB10424) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.

Uniprot Information

UniProt Protein Function:ENTPD3: Has a threefold preference for the hydrolysis of ATP over ADP. Belongs to the GDA1/CD39 NTPase family.
UniProt Protein Details:

Protein type:Hydrolase; EC 3.6.1.5; Membrane protein, integral; Phosphatase (non-protein); Nucleotide Metabolism - purine; Membrane protein, multi-pass; Nucleotide Metabolism - pyrimidine

Chromosomal Location of Human Ortholog: 3p21.3

Molecular Function:protein binding

NCBI Summary:This gene encodes a plasma membrane-bound divalent cation-dependent E-type nucleotidase. The encoded protein is involved in the regulation of extracellular levels of ATP by hydrolysis of it and other nucleotides. Multiple transcript variants have been described. [provided by RefSeq, May 2014]
UniProt Code:O75355
NCBI GenInfo Identifier:115311595
NCBI Gene ID:956
NCBI Accession:O75355.2
UniProt Secondary Accession:O75355,O60495, Q8N6K2, B2R8D0, G5E9N0,
UniProt Related Accession:O75355
Molecular Weight:50,762 Da
NCBI Full Name:Ectonucleoside triphosphate diphosphohydrolase 3
NCBI Synonym Full Names:ectonucleoside triphosphate diphosphohydrolase 3
NCBI Official Symbol:ENTPD3
NCBI Official Synonym Symbols:HB6; CD39L3; NTPDase-3
NCBI Protein Information:ectonucleoside triphosphate diphosphohydrolase 3
UniProt Protein Name:Ectonucleoside triphosphate diphosphohydrolase 3
UniProt Synonym Protein Names:CD39 antigen-like 3; Ecto-ATP diphosphohydrolase 3; Ecto-ATPDase 3; Ecto-ATPase 3; Ecto-apyrase 3; HB6
Protein Family:Ectonucleoside triphosphate diphosphohydrolase
UniProt Gene Name:ENTPD3
UniProt Entry Name:ENTP3_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Mouse
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose