FBXO24 Rabbit Polyclonal Antibody

(No reviews yet) Write a Review
SKU:
CAB13770
€99 - €249

Description

Technical Manual

FBXO24 Rabbit Polyclonal Antibody

Product Name:FBXO24 Rabbit Polyclonal Antibody
Product SKU:CAB13770
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human FBXO24 (NP_277041.1).
Sequence:

MGEKAVPLLRRRRVKRSCPSCGSELGVEEKRGKGNPISIQLFPPELVEHIISFLPVRDLVALGQTCRYFHEVCDGEGVWRRICRRLSPRLQDQGSGVRPWKRAAILNYTKGLYFQAFGGRRRCLSKSVAPLLAHGYRRFLPTKDHVFILD

Gene ID:26261
Swiss Prot:O75426
Synonyms:FBXO24; FBX24
Calculated MW:36kDa/63kDa/64kDa/69kDa
Observed MW:64kDa
Reactivity:Human, Mouse
Application:WB
Recommended Dilution:WB 1:500 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting 
Positive Samples:MCF7
Cellular Location:

Product Images

FBXO24 Rabbit Polyclonal Antibody

Western blot - FBXO24 Polyclonal Antibody (CAB13770)

Uniprot Information

UniProt Protein Function:FBXO24: Substrate-recognition component of the SCF (SKP1-CUL1-F- box protein)-type E3 ubiquitin ligase complex. 4 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Chromosomal Location of Human Ortholog: 7q22

Molecular Function:protein binding

NCBI Summary:This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2009]
UniProt Code:O75426
NCBI GenInfo Identifier:51338744
NCBI Gene ID:26261
NCBI Accession:O75426.2
UniProt Secondary Accession:O75426,Q9H0G1, A4D2D4, B4DX91, B4DY42,
UniProt Related Accession:O75426
Molecular Weight:63,456 Da
NCBI Full Name:F-box only protein 24
NCBI Synonym Full Names:F-box protein 24
NCBI Official Symbol:FBXO24 
NCBI Official Synonym Symbols:FBX24 
NCBI Protein Information:F-box only protein 24
UniProt Protein Name:F-box only protein 24
Protein Family:F-box only protein
UniProt Gene Name:FBXO24 
UniProt Entry Name:FBX24_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Mouse
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
View AllClose

0 Reviews

View AllClose