Anti-INTS9 Antibody (CAB10480)

SKU:
CAB10480
€99 - €249

Description

Technical Manual

Anti-INTS9 Antibody

Product Name:Anti-INTS9 Antibody
Product SKU:CAB10480
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene encodes a subunit of the Integrator complex. This protein complex binds the C-terminal domain of RNA polymerase II and likely plays a role in small nuclear RNA processing. The encoded protein has similarities to the subunits of the cleavage and polyadenylation specificity factor complex. Alternatively spliced transcript variants have been described.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 459-658 of human INTS9 (NP_060720.2).
Sequence:

KLLKEVQPLHVVCPEQYTQPPPAQSHRMDLMIDCQPPAMSYRRAEVLALPFKRRYEKIEIMPELADSLVPMEIKPGISLATVSAVLHTKDNKHLLQPPPRPAQPTSGKKRKRVSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDNDEMLRVRLRDLVLKFLQKF

Gene ID:55756
Swiss Prot:Q9NV88
Synonyms:INTS9; CPSF2L; INT9; RC74
Calculated MW:71kDa/73kDa
Observed MW:74kDa
Reactivity:Human
Application:WB
Recommended Dilution:WB 1:1000 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting 
Positive Samples:U-251MG, HeLa, Jurkat, 293T
Cellular Location:Nucleus

Product Images

Anti-INTS9 Antibody (CAB10480)

Western blot analysis of extracts of various cell lines, using INTS9 antibody (CAB10480) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s.

Uniprot Information

UniProt Protein Function:INTS9: Component of the Integrator complex, a complex involved in the small nuclear RNAs (snRNA) U1 and U2 transcription and in their 3'-box-dependent processing. The Integrator complex is associated with the C-terminal domain (CTD) of RNA polymerase II largest subunit (POLR2A) and is recruited to the U1 and U2 snRNAs genes. Belongs to the metallo-beta-lactamase superfamily. RNA-metabolizing metallo-beta-lactamase-like family. INTS9 subfamily. 3 isoforms of the human protein are produced by alternative splicing.
UniProt Protein Details:

Chromosomal Location of Human Ortholog: 8p21.1

Cellular Component: nucleoplasm; cytoplasm; integrator complex

Molecular Function:protein binding

Biological Process: snRNA processing

NCBI Summary:This gene encodes a subunit of the Integrator complex. This protein complex binds the C-terminal domain of RNA polymerase II and likely plays a role in small nuclear RNA processing. The encoded protein has similarities to the subunits of the cleavage and polyadenylation specificity factor complex. Alternatively spliced transcript variants have been described.[provided by RefSeq, Feb 2010]
UniProt Code:Q9NV88
NCBI GenInfo Identifier:119371246
NCBI Gene ID:55756
NCBI Accession:Q9NV88.2
UniProt Related Accession:Q9NV88
Molecular Weight:71kDa; 73kDa
NCBI Full Name:Integrator complex subunit 9
NCBI Synonym Full Names:integrator complex subunit 9
NCBI Official Symbol:INTS9 
NCBI Official Synonym Symbols:INT9; RC74; CPSF2L 
NCBI Protein Information:integrator complex subunit 9
UniProt Protein Name:Integrator complex subunit 9
UniProt Synonym Protein Names:Protein related to CPSF subunits of 74 kDa; RC-74
Protein Family:Integrator complex
UniProt Gene Name:INTS9 
UniProt Entry Name:INT9_HUMAN
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose