Anti-KLHL26 Antibody (CAB10374)

SKU:
CAB10374
€99 - €249

Description

Technical Manual

Anti-KLHL26 Antibody

Product Name:Anti-KLHL26 Antibody
Product SKU:CAB10374
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:
Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 366-615 of human KLHL26 (NP_060786.1).
Sequence:

AGGQHLQYRSGEGAVDACYRYDPHLNRWLRLQAMQESRIQFQLNVLCGMVYATGGRNRAGSLASVERYCPRRNEWGYACSLKRRTWGHAGAASGGRLYISGGYGISVEDKKALHCYDPVADQWEFKAPMSEPRVLHAMVGAGGRIYALGGRMDHVDRCFDVLAVEYYVPETDQWTSVSPMRAGQSEAGCCLLERKIYIVGGYNWRLNNVTGIVQVYNTDTDEWERDLHFPESFAGIACAPVLLPRAGTRR

Gene ID:55295
Swiss Prot:Q53HC5
Synonyms:KLHL26
Calculated MW:68kDa
Observed MW:70kDa
Reactivity:Human, Rat
Application:WB
Recommended Dilution:WB 1:500 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting
Positive Samples:U-87MG, HeLa, K-562, Jurkat, MCF7, Rat brain
Cellular Location:

Product Images

Anti-KLHL26 Antibody (CAB10374)

Western blot analysis of extracts of various cell lines, using KLHL26 antibody (CAB10374) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s.

Uniprot Information

UniProt Protein Function:KLHL26:
UniProt Protein Details:

Chromosomal Location of Human Ortholog: 19p13.11

Cellular Component: cytoplasm

Molecular Function:ubiquitin-protein ligase activity

Biological Process: fertilization; male gonad development; spermatid development

UniProt Code:Q53HC5
NCBI GenInfo Identifier:109892505
NCBI Gene ID:55295
NCBI Accession:Q53HC5.2
UniProt Secondary Accession:Q53HC5,Q8TAP0, Q9NUX3,
UniProt Related Accession:Q53HC5
Molecular Weight:68kDa
NCBI Full Name:Kelch-like protein 26
NCBI Synonym Full Names:kelch like family member 26
NCBI Official Symbol:KLHL26
NCBI Protein Information:kelch-like protein 26
UniProt Protein Name:Kelch-like protein 26
Protein Family:Kelch-like protein
UniProt Gene Name:KLHL26
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Human
Reactivity:
Rat
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose