Anti-GPR126 Antibody (CAB10318)

SKU:
CAB10318
€99 - €249

Description

Technical Manual

Anti-GPR126 Antibody

Product Name:Anti-GPR126 Antibody
Product SKU:CAB10318
Size:20uL, 50 uL
Host Species:Rabbit
Purification Method:Affinity purification
Isotype:IgG
Background:

This gene, which is upregulated in human umbilical vein endothelial cells, encodes a G protein-coupled receptor. Variations in this gene can affect a person's stature. Multiple transcript variants encoding different proteins have been found for this gene.

Immunogen:Recombinant fusion protein containing a sequence corresponding to amino acids 40-300 of human GPR126 (NP_001027567.1).
Sequence:

NCRVVLSNPSGTFTSPCYPNDYPNSQACMWTLRAPTGYIIQITFNDFDIEEAPNCIYDSLSLDNGESQTKFCGATAKGLSFNSSANEMHVSFSSDFSIQKKGFNASYIRVAVSLRNQKVILPQTSDAYQVSVAKSISIPELSAFTLCFEATKVGHEDSDWTAFSYSNASFTQLLSFGKAKSGYFLSISDSKCLLNNALPVKEKEDIFAESFEQLCLVWNNSLGSIGVNFKRNYETVPCDSTISKVIPGNGKLLLGSNQNEI

Gene ID:57211
Swiss Prot:Q86SQ4
Synonyms:ADGRG6; APG1; DREG; GPR126; LCCS9; PR126; PS1TP2; VIGR; STQTL1
Calculated MW:133kDa/136kDa/139kDa
Observed MW:160kDa
Reactivity:Mouse
Application:WB
Recommended Dilution:WB 1:500 - 1:2000
Storage Buffer:Store at -20'C. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Application Key:Western blotting
Positive Samples:Mouse heart
Cellular Location:Cell membrane, Multi-pass membrane protein

Product Images

Anti-GPR126 Antibody (CAB10318)

Western blot analysis of extracts of mouse heart, using GPR126 antibody (CAB10318) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (CABS014) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 5s.

Uniprot Information

UniProt Protein Function:G-protein coupled receptor which is activated by type IV collagen, a major constituent of the basement membrane. Couples to G(i)-proteins as well as G(s)-proteins (PubMed:24227709). Essential for normal differentiation of promyelinating Schwann cells and for normal myelination of axons (PubMed:24227709). Regulates neural, cardiac and ear development via G-protein- and/or N-terminus-dependent signaling. May act as a receptor for PRNP which may promote myelin homeostasis.
NCBI Summary:This gene, which is upregulated in human umbilical vein endothelial cells, encodes a G protein-coupled receptor. Variations in this gene can affect a person's stature. Multiple transcript variants encoding different proteins have been found for this gene. [provided by RefSeq, Mar 2009]
UniProt Code:Q86SQ4
NCBI GenInfo Identifier:215274152
NCBI Gene ID:57211
NCBI Accession:Q86SQ4.3
UniProt Secondary Accession:Q86SQ4,Q5TGN7, Q6DHZ4, Q6F3F5, Q6F3F6, Q6F3F7, Q6F3F8 Q6MZU7, Q8IXA4, Q8NC14, Q96JW0,
UniProt Related Accession:Q86SQ4
Molecular Weight:137kDa
NCBI Full Name:Adhesion G-protein coupled receptor G6
NCBI Synonym Full Names:adhesion G protein-coupled receptor G6
NCBI Official Symbol:ADGRG6
NCBI Official Synonym Symbols:APG1; DREG; VIGR; LCCS9; PR126; GPR126; PS1TP2
NCBI Protein Information:adhesion G-protein coupled receptor G6; G-protein coupled receptor 126
UniProt Protein Name:Adhesion G-protein coupled receptor G6
UniProt Synonym Protein Names:Developmentally regulated G-protein-coupled receptor
Protein Family:G-protein coupled receptor
UniProt Gene Name:ADGRG6
View AllClose

Additional Information

Product type:
Antibody
Reactivity:
Mouse
Host Species:
Rabbit
Isotype:
IgG
Antibody Type:
Polyclonal Antibody
Research Area:
Cell Biology
View AllClose